C14orf166,CGI-99
  • C14orf166,CGI-99

Anti-C14orf166 Antibody 100ul

Ref: AN-HPA039824-100ul
Anti-C14orf166

Información del producto

Polyclonal Antibody against Human C14orf166, Gene description: chromosome 14 open reading frame 166, Alternative Gene Names: CGI-99, CLE, CLE7, LCRP369, RLLM1, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y224, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C14orf166
Gene Description chromosome 14 open reading frame 166
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence ALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNS
Immunogen ALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-99, CLE, CLE7, LCRP369, RLLM1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y224
HTS Code 3002150000
Gene ID 51637
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C14orf166 Antibody 100ul

Anti-C14orf166 Antibody 100ul