THAP2,DKFZP564I0422
  • THAP2,DKFZP564I0422

Anti-THAP2 Antibody 100ul

Ref: AN-HPA039790-100ul
Anti-THAP2

Información del producto

Polyclonal Antibody against Human THAP2, Gene description: THAP domain containing, apoptosis associated protein 2, Alternative Gene Names: DKFZP564I0422, Validated applications: ICC, IHC, Uniprot ID: Q9H0W7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name THAP2
Gene Description THAP domain containing, apoptosis associated protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence KSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLED
Immunogen KSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLED
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP564I0422
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H0W7
HTS Code 3002150000
Gene ID 83591
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-THAP2 Antibody 100ul

Anti-THAP2 Antibody 100ul