NAA16,FLJ22054
  • NAA16,FLJ22054

Anti-NAA16 Antibody 25ul

Ref: AN-HPA039761-25ul
Anti-NAA16

Información del producto

Polyclonal Antibody against Human NAA16, Gene description: N(alpha)-acetyltransferase 16, NatA auxiliary subunit, Alternative Gene Names: FLJ22054, MGC40612, NARG1L, PRO2435, Validated applications: ICC, IHC, Uniprot ID: Q6N069, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NAA16
Gene Description N(alpha)-acetyltransferase 16, NatA auxiliary subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence FAINSNNPWLHECLIRFSKSVSNHSNLPDIVSKVLSQEMQKIFVKKDLESFNEDFLKRNATSLQHLLSGAKMMYFLDKSRQEKA
Immunogen FAINSNNPWLHECLIRFSKSVSNHSNLPDIVSKVLSQEMQKIFVKKDLESFNEDFLKRNATSLQHLLSGAKMMYFLDKSRQEKA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22054, MGC40612, NARG1L, PRO2435
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6N069
HTS Code 3002150000
Gene ID 79612
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NAA16 Antibody 25ul

Anti-NAA16 Antibody 25ul