FOXRED1,H17
  • FOXRED1,H17

Anti-FOXRED1 Antibody 25ul

Ref: AN-HPA039620-25ul
Anti-FOXRED1

Información del producto

Polyclonal Antibody against Human FOXRED1, Gene description: FAD-dependent oxidoreductase domain containing 1, Alternative Gene Names: H17, Validated applications: ICC, WB, Uniprot ID: Q96CU9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FOXRED1
Gene Description FAD-dependent oxidoreductase domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence LSVGGIRQQFSLPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQEGAKVSLMSPDQLRNK
Immunogen LSVGGIRQQFSLPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQEGAKVSLMSPDQLRNK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names H17
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96CU9
HTS Code 3002150000
Gene ID 55572
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FOXRED1 Antibody 25ul

Anti-FOXRED1 Antibody 25ul