WDR19,DYF-2
  • WDR19,DYF-2

Anti-WDR19 Antibody 25ul

Ref: AN-HPA039616-25ul
Anti-WDR19

Información del producto

Polyclonal Antibody against Human WDR19, Gene description: WD repeat domain 19, Alternative Gene Names: DYF-2, FLJ23127, IFT144, KIAA1638, NPHP13, ORF26, Oseg6, Pwdmp, Validated applications: ICC, IHC, Uniprot ID: Q8NEZ3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WDR19
Gene Description WD repeat domain 19
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence TGADYIVKIFDRHGQKRSEINLPGNCVAMDWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRDQMSFLLWSKVGSFLAVGTVKG
Immunogen TGADYIVKIFDRHGQKRSEINLPGNCVAMDWDKDGDVLAVIAEKSSCIYLWDANTNKTSQLDNGMRDQMSFLLWSKVGSFLAVGTVKG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DYF-2, FLJ23127, IFT144, KIAA1638, NPHP13, ORF26, Oseg6, Pwdmp
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NEZ3
HTS Code 3002150000
Gene ID 57728
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-WDR19 Antibody 25ul

Anti-WDR19 Antibody 25ul