METTL25,C12orf26
  • METTL25,C12orf26

Anti-METTL25 Antibody 100ul

Ref: AN-HPA039534-100ul
Anti-METTL25

Información del producto

Polyclonal Antibody against Human METTL25, Gene description: methyltransferase like 25, Alternative Gene Names: C12orf26, FLJ22789, Validated applications: IHC, WB, Uniprot ID: Q8N6Q8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name METTL25
Gene Description methyltransferase like 25
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence TSEANKERRKMTSKSSESNIYSPLTSFITADSELHDIIKDLEDCLMVGLHTCGDLAPNTLRIFTSNSEIKGVCSVGRCYHLLSEEFENQHKERTQEKW
Immunogen TSEANKERRKMTSKSSESNIYSPLTSFITADSELHDIIKDLEDCLMVGLHTCGDLAPNTLRIFTSNSEIKGVCSVGRCYHLLSEEFENQHKERTQEKW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C12orf26, FLJ22789
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N6Q8
HTS Code 3002150000
Gene ID 84190
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-METTL25 Antibody 100ul

Anti-METTL25 Antibody 100ul