SPR,SDR38C1
  • SPR,SDR38C1

Anti-SPR Antibody 25ul

Ref: AN-HPA039505-25ul
Anti-SPR

Información del producto

Polyclonal Antibody against Human SPR, Gene description: sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase), Alternative Gene Names: SDR38C1, Validated applications: ICC, IHC, WB, Uniprot ID: P35270, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SPR
Gene Description sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFY
Immunogen LEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SDR38C1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P35270
HTS Code 3002150000
Gene ID 6697
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SPR Antibody 25ul

Anti-SPR Antibody 25ul