UBE3A,ANCR,AS,E6-AP
  • UBE3A,ANCR,AS,E6-AP

Anti-UBE3A Antibody 100ul

Ref: AN-HPA039410-100ul
Anti-UBE3A

Información del producto

Polyclonal Antibody against Human UBE3A, Gene description: ubiquitin protein ligase E3A, Alternative Gene Names: ANCR, AS, E6-AP, EPVE6AP, FLJ26981, HPVE6A, Validated applications: ICC, IHC, WB, Uniprot ID: Q05086, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UBE3A
Gene Description ubiquitin protein ligase E3A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence HLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIK
Immunogen HLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ANCR, AS, E6-AP, EPVE6AP, FLJ26981, HPVE6A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q05086
HTS Code 3002150000
Gene ID 7337
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UBE3A Antibody 100ul

Anti-UBE3A Antibody 100ul