MRPL42,HSPC204
  • MRPL42,HSPC204

Anti-MRPL42 Antibody 100ul

Ref: AN-HPA039398-100ul
Anti-MRPL42

Información del producto

Polyclonal Antibody against Human MRPL42, Gene description: mitochondrial ribosomal protein L42, Alternative Gene Names: HSPC204, MRP-L31, MRPL31, MRPS32, PTD007, RPML31, Validated applications: ICC, IHC, Uniprot ID: Q9Y6G3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPL42
Gene Description mitochondrial ribosomal protein L42
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence YEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKD
Immunogen YEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSPC204, MRP-L31, MRPL31, MRPS32, PTD007, RPML31
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y6G3
HTS Code 3002150000
Gene ID 28977
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MRPL42 Antibody 100ul

Anti-MRPL42 Antibody 100ul