DCUN1D2,C13orf17
  • DCUN1D2,C13orf17

Anti-DCUN1D2 Antibody 100ul

Ref: AN-HPA039349-100ul
Anti-DCUN1D2

Información del producto

Polyclonal Antibody against Human DCUN1D2, Gene description: DCN1, defective in cullin neddylation 1, domain containing 2, Alternative Gene Names: C13orf17, FLJ10704, FLJ20092, Validated applications: ICC, IHC, Uniprot ID: Q6PH85, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DCUN1D2
Gene Description DCN1, defective in cullin neddylation 1, domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence QFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRY
Immunogen QFMACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C13orf17, FLJ10704, FLJ20092
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6PH85
HTS Code 3002150000
Gene ID 55208
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DCUN1D2 Antibody 100ul

Anti-DCUN1D2 Antibody 100ul