LRRC18,MGC34773 View larger

Anti-LRRC18 Antibody 100ul

AN-HPA039256-100ul

New product

Anti-LRRC18

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.


Data sheet

Size 100ul
Gene Name LRRC18
Gene Description leucine rich repeat containing 18
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence IFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRL
Immunogen IFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC34773, UNQ933, UNQ9338, VKGE9338
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N456
HTS Code 3002150000
Gene ID 474354
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicativo WB, IHC
Conjugation Unconjugated

More info

Polyclonal Antibody against Human LRRC18, Gene description: leucine rich repeat containing 18, Alternative Gene Names: MGC34773, UNQ933, UNQ9338, VKGE9338, Validated applications: IHC, WB, Uniprot ID: Q8N456, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image