MARK4,FLJ90097
  • MARK4,FLJ90097

Anti-MARK4 Antibody 25ul

Ref: AN-HPA039186-25ul
Anti-MARK4

Información del producto

Polyclonal Antibody against Human MARK4, Gene description: MAP/microtubule affinity-regulating kinase 4, Alternative Gene Names: FLJ90097, KIAA1860, MARKL1, Nbla00650, PAR-1D, Validated applications: ICC, IHC, Uniprot ID: Q96L34, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MARK4
Gene Description MAP/microtubule affinity-regulating kinase 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence PSDTTNGTSSSKGTSHSKGQRSSSSTYHRQRRHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSR
Immunogen PSDTTNGTSSSKGTSHSKGQRSSSSTYHRQRRHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ90097, KIAA1860, MARKL1, Nbla00650, PAR-1D
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96L34
HTS Code 3002150000
Gene ID 57787
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MARK4 Antibody 25ul

Anti-MARK4 Antibody 25ul