MYOZ3,CS-3,CS3,FRP3
  • MYOZ3,CS-3,CS3,FRP3

Anti-MYOZ3 Antibody 25ul

Ref: AN-HPA039166-25ul
Anti-MYOZ3

Información del producto

Polyclonal Antibody against Human MYOZ3, Gene description: myozenin 3, Alternative Gene Names: CS-3, CS3, FRP3, Validated applications: IHC, Uniprot ID: Q8TDC0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MYOZ3
Gene Description myozenin 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLRLRPSFNRVAQGWVRNLPESEEL
Immunogen CPWQEFVSYRDYQSDGRSHTPSPNDYRNFNKTPVPFGGPLVGGTFPRPGTPFIPEPLSGLELLRLRPSFNRVAQGWVRNLPESEEL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CS-3, CS3, FRP3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TDC0
HTS Code 3002150000
Gene ID 91977
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MYOZ3 Antibody 25ul

Anti-MYOZ3 Antibody 25ul