AKAP11,AKAP220
  • AKAP11,AKAP220

Anti-AKAP11 Antibody 25ul

Ref: AN-HPA039089-25ul
Anti-AKAP11

Información del producto

Polyclonal Antibody against Human AKAP11, Gene description: A kinase (PRKA) anchor protein 11, Alternative Gene Names: AKAP220, DKFZp781I12161, FLJ11304, KIAA0629, PPP1R44, PRKA11, Validated applications: IHC, Uniprot ID: Q9UKA4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name AKAP11
Gene Description A kinase (PRKA) anchor protein 11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EHSGKKVQFAEALATHILSLATEMAASHLDNKIIQEPKVKNPCLNVQSQRSVSPTFLNPSDENLKTLCNFAGDLAAEVITEAEKIAKVRNCM
Immunogen EHSGKKVQFAEALATHILSLATEMAASHLDNKIIQEPKVKNPCLNVQSQRSVSPTFLNPSDENLKTLCNFAGDLAAEVITEAEKIAKVRNCM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AKAP220, DKFZp781I12161, FLJ11304, KIAA0629, PPP1R44, PRKA11
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UKA4
HTS Code 3002150000
Gene ID 11215
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-AKAP11 Antibody 25ul

Anti-AKAP11 Antibody 25ul