CD7,GP40,LEU-9,Tp40
  • CD7,GP40,LEU-9,Tp40

Anti-CD7 Antibody 25ul

Ref: AN-HPA039079-25ul
Anti-CD7

Información del producto

Polyclonal Antibody against Human CD7, Gene description: CD7 molecule, Alternative Gene Names: GP40, LEU-9, Tp40, TP41, Validated applications: IHC, Uniprot ID: P09564, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CD7
Gene Description CD7 molecule
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAAS
Immunogen YTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAAS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GP40, LEU-9, Tp40, TP41
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P09564
HTS Code 3002150000
Gene ID 924
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CD7 Antibody 25ul

Anti-CD7 Antibody 25ul