PACS1,FLJ10209
  • PACS1,FLJ10209

Anti-PACS1 Antibody 25ul

Ref: AN-HPA038914-25ul
Anti-PACS1

Información del producto

Polyclonal Antibody against Human PACS1, Gene description: phosphofurin acidic cluster sorting protein 1, Alternative Gene Names: FLJ10209, KIAA1175, Validated applications: ICC, IHC, Uniprot ID: Q6VY07, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PACS1
Gene Description phosphofurin acidic cluster sorting protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence DTTSPMELAALEKIKSTWIKNQDDSLTETDTLEITDQDMFGDASTSLVVPEKVKTPMKSSKTDLQGSASPSKVEGVHTPRQKRSTPLKERQLSKPLSE
Immunogen DTTSPMELAALEKIKSTWIKNQDDSLTETDTLEITDQDMFGDASTSLVVPEKVKTPMKSSKTDLQGSASPSKVEGVHTPRQKRSTPLKERQLSKPLSE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10209, KIAA1175
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6VY07
HTS Code 3002150000
Gene ID 55690
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PACS1 Antibody 25ul

Anti-PACS1 Antibody 25ul