GTSF1,FAM112B
  • GTSF1,FAM112B

Anti-GTSF1 Antibody 100ul

Ref: AN-HPA038876-100ul
Anti-GTSF1

Información del producto

Polyclonal Antibody against Human GTSF1, Gene description: gametocyte specific factor 1, Alternative Gene Names: FAM112B, FLJ32942, Validated applications: IHC, WB, Uniprot ID: Q8WW33, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GTSF1
Gene Description gametocyte specific factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence DPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQ
Immunogen DPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM112B, FLJ32942
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WW33
HTS Code 3002150000
Gene ID 121355
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GTSF1 Antibody 100ul

Anti-GTSF1 Antibody 100ul