C11orf96,AG2
  • C11orf96,AG2

Anti-C11orf96 Antibody 25ul

Ref: AN-HPA038843-25ul
Anti-C11orf96

Información del producto

Polyclonal Antibody against Human C11orf96, Gene description: chromosome 11 open reading frame 96, Alternative Gene Names: AG2, Validated applications: ICC, IHC, Uniprot ID: Q7Z7L8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name C11orf96
Gene Description chromosome 11 open reading frame 96
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence RQSRFKTQPVTFDEIQEVEEEGVSPMEEEKAKKSFLQSLECLRRSTQSLSLQREQLSSCKLRNSLDSS
Immunogen RQSRFKTQPVTFDEIQEVEEEGVSPMEEEKAKKSFLQSLECLRRSTQSLSLQREQLSSCKLRNSLDSS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AG2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7Z7L8
HTS Code 3002150000
Gene ID 387763
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C11orf96 Antibody 25ul

Anti-C11orf96 Antibody 25ul