PDZRN3,KIAA1095
  • PDZRN3,KIAA1095

Anti-PDZRN3 Antibody 25ul

Ref: AN-HPA038822-25ul
Anti-PDZRN3

Información del producto

Polyclonal Antibody against Human PDZRN3, Gene description: PDZ domain containing ring finger 3, Alternative Gene Names: KIAA1095, LNX3, SEMACAP3, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UPQ7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PDZRN3
Gene Description PDZ domain containing ring finger 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PDNSLRRAAEGISCPSSEGAVGTTEAYGPASKNLLSITEDPEVGTPTYSPSLKELDPNQPLESKERRASDGSRSPTPSQKLGSAYLPSYHHSP
Immunogen PDNSLRRAAEGISCPSSEGAVGTTEAYGPASKNLLSITEDPEVGTPTYSPSLKELDPNQPLESKERRASDGSRSPTPSQKLGSAYLPSYHHSP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1095, LNX3, SEMACAP3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UPQ7
HTS Code 3002150000
Gene ID 23024
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PDZRN3 Antibody 25ul

Anti-PDZRN3 Antibody 25ul