ARHGAP44,KIAA0672
  • ARHGAP44,KIAA0672

Anti-ARHGAP44 Antibody 25ul

Ref: AN-HPA038814-25ul
Anti-ARHGAP44

Información del producto

Polyclonal Antibody against Human ARHGAP44, Gene description: Rho GTPase activating protein 44, Alternative Gene Names: KIAA0672, RICH-2, RICH2, Validated applications: IHC, WB, Uniprot ID: Q17R89, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ARHGAP44
Gene Description Rho GTPase activating protein 44
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence STPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMSTDLVHFDIPSIHIELGSTLRLSPLEHMRRHSVTDKRDSE
Immunogen STPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMSTDLVHFDIPSIHIELGSTLRLSPLEHMRRHSVTDKRDSE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0672, RICH-2, RICH2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q17R89
HTS Code 3002150000
Gene ID 9912
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ARHGAP44 Antibody 25ul

Anti-ARHGAP44 Antibody 25ul