CAPZA3,CAPPA3,Gsg3
  • CAPZA3,CAPPA3,Gsg3

Anti-CAPZA3 Antibody 25ul

Ref: AN-HPA038688-25ul
Anti-CAPZA3

Información del producto

Polyclonal Antibody against Human CAPZA3, Gene description: capping protein (actin filament) muscle Z-line, alpha 3, Alternative Gene Names: CAPPA3, Gsg3, Validated applications: IHC, Uniprot ID: Q96KX2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CAPZA3
Gene Description capping protein (actin filament) muscle Z-line, alpha 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLCIDGNPVLLSHHNVMGDYRFFDHQSKLSFKYDLLQN
Immunogen KDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLCIDGNPVLLSHHNVMGDYRFFDHQSKLSFKYDLLQN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAPPA3, Gsg3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96KX2
HTS Code 3002150000
Gene ID 93661
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CAPZA3 Antibody 25ul

Anti-CAPZA3 Antibody 25ul