CCDC73,NY-SAR-79
  • CCDC73,NY-SAR-79

Anti-CCDC73 Antibody 100ul

Ref: AN-HPA038669-100ul
Anti-CCDC73

Información del producto

Polyclonal Antibody against Human CCDC73, Gene description: coiled-coil domain containing 73, Alternative Gene Names: NY-SAR-79, Validated applications: IHC, Uniprot ID: Q6ZRK6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCDC73
Gene Description coiled-coil domain containing 73
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LTVPCDIVIDHHVSYAAFSANSKLLLKNSDKNVHSMSMLVKPNSSPGGKTMCKNMSDMQNSQFNNCLGYLENTNVNISHLHLNNENSHASQAKDVKTA
Immunogen LTVPCDIVIDHHVSYAAFSANSKLLLKNSDKNVHSMSMLVKPNSSPGGKTMCKNMSDMQNSQFNNCLGYLENTNVNISHLHLNNENSHASQAKDVKTA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NY-SAR-79
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZRK6
HTS Code 3002150000
Gene ID 493860
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCDC73 Antibody 100ul

Anti-CCDC73 Antibody 100ul