STK38L,KIAA0965,NDR2
  • STK38L,KIAA0965,NDR2

Anti-STK38L Antibody 100ul

Ref: AN-HPA038623-100ul
Anti-STK38L

Información del producto

Polyclonal Antibody against Human STK38L, Gene description: serine/threonine kinase 38 like, Alternative Gene Names: KIAA0965, NDR2, Validated applications: IHC, WB, Uniprot ID: Q9Y2H1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name STK38L
Gene Description serine/threonine kinase 38 like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDL
Immunogen STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPISEKAKDL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0965, NDR2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y2H1
HTS Code 3002150000
Gene ID 23012
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-STK38L Antibody 100ul

Anti-STK38L Antibody 100ul