MTPAP,FLJ10486
  • MTPAP,FLJ10486

Anti-MTPAP Antibody 25ul

Ref: AN-HPA038620-25ul
Anti-MTPAP

Información del producto

Polyclonal Antibody against Human MTPAP, Gene description: mitochondrial poly(A) polymerase, Alternative Gene Names: FLJ10486, mtPAP, PAPD1, SPAX4, Validated applications: IHC, Uniprot ID: Q9NVV4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MTPAP
Gene Description mitochondrial poly(A) polymerase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ETLELLLKEFFEYFGNFAFDKNSINIRQGREQNKPDSSPLYIQNPFETSLNISKNVSQSQLQKFVDLARESAWILQQEDTDRPSISSNRPWGLVSLLLPS
Immunogen ETLELLLKEFFEYFGNFAFDKNSINIRQGREQNKPDSSPLYIQNPFETSLNISKNVSQSQLQKFVDLARESAWILQQEDTDRPSISSNRPWGLVSLLLPS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10486, mtPAP, PAPD1, SPAX4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NVV4
HTS Code 3002150000
Gene ID 55149
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MTPAP Antibody 25ul

Anti-MTPAP Antibody 25ul