CUTC,CGI-32
  • CUTC,CGI-32

Anti-CUTC Antibody 25ul

Ref: AN-HPA038619-25ul
Anti-CUTC

Información del producto

Polyclonal Antibody against Human CUTC, Gene description: cutC copper transporter, Alternative Gene Names: CGI-32, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NTM9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CUTC
Gene Description cutC copper transporter
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB, ICC
Sequence KRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREIEVMKADI
Immunogen KRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGADRIELCSGLSEGGTTPSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREIEVMKADI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-32
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NTM9
HTS Code 3002150000
Gene ID 51076
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CUTC Antibody 25ul

Anti-CUTC Antibody 25ul