TBCEL,LRRC35
  • TBCEL,LRRC35

Anti-TBCEL Antibody 25ul

Ref: AN-HPA038594-25ul
Anti-TBCEL

Información del producto

Polyclonal Antibody against Human TBCEL, Gene description: tubulin folding cofactor E-like, Alternative Gene Names: LRRC35, MGC10233, Validated applications: ICC, IHC, WB, Uniprot ID: Q5QJ74, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TBCEL
Gene Description tubulin folding cofactor E-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence VLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLR
Immunogen VLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LRRC35, MGC10233
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5QJ74
HTS Code 3002150000
Gene ID 219899
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TBCEL Antibody 25ul

Anti-TBCEL Antibody 25ul