RNF111,ARK,Arkadia
  • RNF111,ARK,Arkadia

Anti-RNF111 Antibody 100ul

Ref: AN-HPA038577-100ul
Anti-RNF111

Información del producto

Polyclonal Antibody against Human RNF111, Gene description: ring finger protein 111, Alternative Gene Names: ARK, Arkadia, DKFZP761D081, FLJ38008, Validated applications: WB, Uniprot ID: Q6ZNA4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RNF111
Gene Description ring finger protein 111
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications WB
Sequence GTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSARSHKWPRTETESVSGLLMKRPCLHGSSLRRLPC
Immunogen GTPSDEDNDSSFSDCLSSPSSSLHFGDSDTVTSDEDKEVSVRHSQTILNAKSRSHSARSHKWPRTETESVSGLLMKRPCLHGSSLRRLPC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ARK, Arkadia, DKFZP761D081, FLJ38008
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZNA4
HTS Code 3002150000
Gene ID 54778
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RNF111 Antibody 100ul

Anti-RNF111 Antibody 100ul