WNT8A,WNT8D
  • WNT8A,WNT8D

Anti-WNT8A Antibody 100ul

Ref: AN-HPA038539-100ul
Anti-WNT8A

Información del producto

Polyclonal Antibody against Human WNT8A, Gene description: wingless-type MMTV integration site family, member 8A, Alternative Gene Names: WNT8D, Validated applications: IHC, WB, Uniprot ID: Q9H1J5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name WNT8A
Gene Description wingless-type MMTV integration site family, member 8A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence MGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNT
Immunogen MGDYLKAKYDQALKIEMDKRQLRAGNSAEGHWVPAEAFLPSAEAELIFLEESPDYCTCNSSLGIYGTEGRECLQNSHNT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names WNT8D
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H1J5
HTS Code 3002150000
Gene ID 7478
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-WNT8A Antibody 100ul

Anti-WNT8A Antibody 100ul