CCDC65,CILD27
  • CCDC65,CILD27

Anti-CCDC65 Antibody 100ul

Ref: AN-HPA038520-100ul
Anti-CCDC65

Información del producto

Polyclonal Antibody against Human CCDC65, Gene description: coiled-coil domain containing 65, Alternative Gene Names: CILD27, FAP250, FLJ35732, NYD-SP28, Validated applications: IHC, Uniprot ID: Q8IXS2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCDC65
Gene Description coiled-coil domain containing 65
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SSVLTPKEQEGIQKNNLEELTEELTKVMVDYIGMENFWKRYNKVKLEQLSLQHRRAQLLDINGKLREMLKQYLDGISVSDEVLSQ
Immunogen SSVLTPKEQEGIQKNNLEELTEELTKVMVDYIGMENFWKRYNKVKLEQLSLQHRRAQLLDINGKLREMLKQYLDGISVSDEVLSQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CILD27, FAP250, FLJ35732, NYD-SP28
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IXS2
HTS Code 3002150000
Gene ID 85478
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCDC65 Antibody 100ul

Anti-CCDC65 Antibody 100ul