MCMBP,C10orf119
  • MCMBP,C10orf119

Anti-MCMBP Antibody 100ul

Ref: AN-HPA038481-100ul
Anti-MCMBP

Información del producto

Polyclonal Antibody against Human MCMBP, Gene description: minichromosome maintenance complex binding protein, Alternative Gene Names: C10orf119, FLJ13081, MCM-BP, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BTE3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MCMBP
Gene Description minichromosome maintenance complex binding protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence SPRNTTLERQTFYCVPVPGESTWVKEAYVNANQARVSPSTSYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLETEASTGQ
Immunogen SPRNTTLERQTFYCVPVPGESTWVKEAYVNANQARVSPSTSYTPSRHKRSYEDDDDMDLQPNKQKDQHAGARQAGSVGGLQWCGEPKRLETEASTGQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C10orf119, FLJ13081, MCM-BP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BTE3
HTS Code 3002150000
Gene ID 79892
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MCMBP Antibody 100ul

Anti-MCMBP Antibody 100ul