REXO2,CGI-114
  • REXO2,CGI-114

Anti-REXO2 Antibody 100ul

Ref: AN-HPA038450-100ul
Anti-REXO2

Información del producto

Polyclonal Antibody against Human REXO2, Gene description: RNA exonuclease 2, Alternative Gene Names: CGI-114, DKFZP566E144, SFN, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y3B8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name REXO2
Gene Description RNA exonuclease 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence YRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS
Immunogen YRIIDVSTVKELCRRWYPEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKIDEKKRKIIENGENEKTVS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-114, DKFZP566E144, SFN
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3B8
HTS Code 3002150000
Gene ID 25996
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-REXO2 Antibody 100ul

Anti-REXO2 Antibody 100ul