SPAG6,CT141,pf16
  • SPAG6,CT141,pf16

Anti-SPAG6 Antibody 100ul

Ref: AN-HPA038440-100ul
Anti-SPAG6

Información del producto

Polyclonal Antibody against Human SPAG6, Gene description: sperm associated antigen 6, Alternative Gene Names: CT141, pf16, Repro-SA-1, Validated applications: IHC, WB, Uniprot ID: O75602, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SPAG6
Gene Description sperm associated antigen 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence AVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEA
Immunogen AVPLLVLCIQEPEIALKRIAASALSDIAKHSPELAQTVVDAGAVAHLAQMILNPDAKLKHQILSALSQVSKHSVDLAEMVVEA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT141, pf16, Repro-SA-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75602
HTS Code 3002150000
Gene ID 9576
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SPAG6 Antibody 100ul

Anti-SPAG6 Antibody 100ul