EXOSC1,CGI-108,CSL4
  • EXOSC1,CGI-108,CSL4

Anti-EXOSC1 Antibody 100ul

Ref: AN-HPA038370-100ul
Anti-EXOSC1

Información del producto

Polyclonal Antibody against Human EXOSC1, Gene description: exosome component 1, Alternative Gene Names: CGI-108, CSL4, Csl4p, hCsl4p, p13, SKI4, Ski4p, Validated applications: IHC, WB, Uniprot ID: Q9Y3B2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EXOSC1
Gene Description exosome component 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence APPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGCLMKSSENGALPVVSVVRETESQLLPDVGAIVTCKVSSINSRFAKVHILYVGSMPLKNS
Immunogen APPVRYCIPGERLCNLEEGSPGSGTYTRHGYIFSSLAGCLMKSSENGALPVVSVVRETESQLLPDVGAIVTCKVSSINSRFAKVHILYVGSMPLKNS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-108, CSL4, Csl4p, hCsl4p, p13, SKI4, Ski4p
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3B2
HTS Code 3002150000
Gene ID 51013
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EXOSC1 Antibody 100ul

Anti-EXOSC1 Antibody 100ul