PCBP2,hnRNP-E2
  • PCBP2,hnRNP-E2

Anti-PCBP2 Antibody 25ul

Ref: AN-HPA038356-25ul
Anti-PCBP2

Información del producto

Polyclonal Antibody against Human PCBP2, Gene description: poly(rC) binding protein 2, Alternative Gene Names: hnRNP-E2, HNRNPE2, HNRPE2, Validated applications: ICC, IHC, Uniprot ID: Q15366, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PCBP2
Gene Description poly(rC) binding protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence IFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEG
Immunogen IFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hnRNP-E2, HNRNPE2, HNRPE2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15366
HTS Code 3002150000
Gene ID 5094
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PCBP2 Antibody 25ul

Anti-PCBP2 Antibody 25ul