MRPL44,FLJ12701
  • MRPL44,FLJ12701

Anti-MRPL44 Antibody 100ul

Ref: AN-HPA038148-100ul
Anti-MRPL44

Información del producto

Polyclonal Antibody against Human MRPL44, Gene description: mitochondrial ribosomal protein L44, Alternative Gene Names: FLJ12701, FLJ13990, Validated applications: IHC, WB, Uniprot ID: Q9H9J2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPL44
Gene Description mitochondrial ribosomal protein L44
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence SGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQ
Immunogen SGLVRLLQQGHRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ12701, FLJ13990
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H9J2
HTS Code 3002150000
Gene ID 65080
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MRPL44 Antibody 100ul

Anti-MRPL44 Antibody 100ul