TSHZ2,C20orf17
  • TSHZ2,C20orf17

Anti-TSHZ2 Antibody 25ul

Ref: AN-HPA038123-25ul
Anti-TSHZ2

Información del producto

Polyclonal Antibody against Human TSHZ2, Gene description: teashirt zinc finger homeobox 2, Alternative Gene Names: C20orf17, OVC10-2, TSH2, ZABC2, ZNF218, Validated applications: ICC, IHC, Uniprot ID: Q9NRE2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TSHZ2
Gene Description teashirt zinc finger homeobox 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SGSVAQLQGGNDTGTDEELETGPEQKGCFSYQNSPGSHLSNQDAENESLLSDASDQVSDIKSVCGRDASDKKAHTHVRLPNEAHNCMDKMTAVYANILSDSYWSGLGLGFKLSNSERRNCDTRNGSNKSDFDWHQDALSK
Immunogen SGSVAQLQGGNDTGTDEELETGPEQKGCFSYQNSPGSHLSNQDAENESLLSDASDQVSDIKSVCGRDASDKKAHTHVRLPNEAHNCMDKMTAVYANILSDSYWSGLGLGFKLSNSERRNCDTRNGSNKSDFDWHQDALSK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C20orf17, OVC10-2, TSH2, ZABC2, ZNF218
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NRE2
HTS Code 3002150000
Gene ID 128553
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSHZ2 Antibody 25ul

Anti-TSHZ2 Antibody 25ul