CSE1L,CAS,CSE1,XPO2
  • CSE1L,CAS,CSE1,XPO2

Anti-CSE1L Antibody 100ul

Ref: AN-HPA038060-100ul
Anti-CSE1L

Información del producto

Polyclonal Antibody against Human CSE1L, Gene description: CSE1 chromosome segregation 1-like (yeast), Alternative Gene Names: CAS, CSE1, XPO2, Validated applications: ICC, IHC, Uniprot ID: P55060, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CSE1L
Gene Description CSE1 chromosome segregation 1-like (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence HGITQANELVNLTEFFVNHILPDLKSANVNEFPVLKADGIKYIMIFRNQVPKEHLLVSIPLLINHLQAESIVVHTYAAHALERLFTMRGPNNATLF
Immunogen HGITQANELVNLTEFFVNHILPDLKSANVNEFPVLKADGIKYIMIFRNQVPKEHLLVSIPLLINHLQAESIVVHTYAAHALERLFTMRGPNNATLF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CAS, CSE1, XPO2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P55060
HTS Code 3002150000
Gene ID 1434
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CSE1L Antibody 100ul

Anti-CSE1L Antibody 100ul