SLC34A2,NAPI-3B
  • SLC34A2,NAPI-3B

Anti-SLC34A2 Antibody 25ul

Ref: AN-HPA037989-25ul
Anti-SLC34A2

Información del producto

Polyclonal Antibody against Human SLC34A2, Gene description: solute carrier family 34 (type II sodium/phosphate contransporter), member 2, Alternative Gene Names: NAPI-3B, Validated applications: IHC, Uniprot ID: O95436, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLC34A2
Gene Description solute carrier family 34 (type II sodium/phosphate contransporter), member 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCGCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECT
Immunogen MRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCGCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NAPI-3B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95436
HTS Code 3002150000
Gene ID 10568
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLC34A2 Antibody 25ul

Anti-SLC34A2 Antibody 25ul