EDA,ED1,ED1-A1
  • EDA,ED1,ED1-A1

Anti-EDA Antibody 100ul

Ref: AN-HPA037973-100ul
Anti-EDA

Información del producto

Polyclonal Antibody against Human EDA, Gene description: ectodysplasin A, Alternative Gene Names: ED1, ED1-A1, ED1-A2, EDA-A1, EDA-A2, EDA1, EDA2, HED, ODT1, XHED, XLHED, Validated applications: ICC, Uniprot ID: Q92838, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name EDA
Gene Description ectodysplasin A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence YYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS
Immunogen YYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ED1, ED1-A1, ED1-A2, EDA-A1, EDA-A2, EDA1, EDA2, HED, ODT1, XHED, XLHED
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92838
HTS Code 3002150000
Gene ID 1896
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-EDA Antibody 100ul

Anti-EDA Antibody 100ul