SHTN1,KIAA1598
  • SHTN1,KIAA1598

Anti-SHTN1 Antibody 25ul

Ref: AN-HPA037943-25ul
Anti-SHTN1

Información del producto

Polyclonal Antibody against Human SHTN1, Gene description: shootin 1, Alternative Gene Names: KIAA1598, shootin-1, shootin1, Validated applications: ICC, WB, Uniprot ID: A0MZ66, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SHTN1
Gene Description shootin 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications WB, ICC
Sequence MNSSDEEKQLQLITSLKEQAIGEYEDLRAENQKTKEKCDKIRQERDEAVKKLEEFQKISHMVIEEVNFMQNHLEIEKTCRESAEALATKLNKEN
Immunogen MNSSDEEKQLQLITSLKEQAIGEYEDLRAENQKTKEKCDKIRQERDEAVKKLEEFQKISHMVIEEVNFMQNHLEIEKTCRESAEALATKLNKEN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1598, shootin-1, shootin1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A0MZ66
HTS Code 3002150000
Gene ID 57698
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SHTN1 Antibody 25ul

Anti-SHTN1 Antibody 25ul