TTC37,KIAA0372
  • TTC37,KIAA0372

Anti-TTC37 Antibody 100ul

Ref: AN-HPA037905-100ul
Anti-TTC37

Información del producto

Polyclonal Antibody against Human TTC37, Gene description: tetratricopeptide repeat domain 37, Alternative Gene Names: KIAA0372, Validated applications: ICC, IHC, Uniprot ID: Q6PGP7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TTC37
Gene Description tetratricopeptide repeat domain 37
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence QLGLTYWFMGEETRKDKTKALTHFLKAARLDTYMGKVFCYLGHYYRDVVGDKNRARGCYRKAFELDDTDAESGAAAVDLSVELEDMEMALAILTTVTQK
Immunogen QLGLTYWFMGEETRKDKTKALTHFLKAARLDTYMGKVFCYLGHYYRDVVGDKNRARGCYRKAFELDDTDAESGAAAVDLSVELEDMEMALAILTTVTQK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0372
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6PGP7
HTS Code 3002150000
Gene ID 9652
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TTC37 Antibody 100ul

Anti-TTC37 Antibody 100ul