TNIP1,ABIN-1
  • TNIP1,ABIN-1

Anti-TNIP1 Antibody 25ul

Ref: AN-HPA037893-25ul
Anti-TNIP1

Información del producto

Polyclonal Antibody against Human TNIP1, Gene description: TNFAIP3 interacting protein 1, Alternative Gene Names: ABIN-1, KIAA0113, NAF1, VAN, Validated applications: IHC, WB, Uniprot ID: Q15025, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TNIP1
Gene Description TNFAIP3 interacting protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKDNELLPP
Immunogen MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLRQKAEELVKDNELLPP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ABIN-1, KIAA0113, NAF1, VAN
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q15025
HTS Code 3002150000
Gene ID 10318
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TNIP1 Antibody 25ul

Anti-TNIP1 Antibody 25ul