XYLB,FLJ10343
  • XYLB,FLJ10343

Anti-XYLB Antibody 100ul

Ref: AN-HPA037863-100ul
Anti-XYLB

Información del producto

Polyclonal Antibody against Human XYLB, Gene description: xylulokinase homolog (H. influenzae), Alternative Gene Names: FLJ10343, FLJ12539, Validated applications: IHC, WB, Uniprot ID: O75191, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name XYLB
Gene Description xylulokinase homolog (H. influenzae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications IHC, WB
Sequence DSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDV
Immunogen DSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSKALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10343, FLJ12539
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75191
HTS Code 3002150000
Gene ID 9942
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-XYLB Antibody 100ul

Anti-XYLB Antibody 100ul