ANAPC16,APC16
  • ANAPC16,APC16

Anti-ANAPC16 Antibody 25ul

Ref: AN-HPA037815-25ul
Anti-ANAPC16

Información del producto

Polyclonal Antibody against Human ANAPC16, Gene description: anaphase promoting complex subunit 16, Alternative Gene Names: APC16, bA570G20.3, C10orf104, CENP-27, FLJ33728, Validated applications: ICC, IHC, Uniprot ID: Q96DE5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ANAPC16
Gene Description anaphase promoting complex subunit 16
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence VSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQ
Immunogen VSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APC16, bA570G20.3, C10orf104, CENP-27, FLJ33728
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96DE5
HTS Code 3002150000
Gene ID 119504
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ANAPC16 Antibody 25ul

Anti-ANAPC16 Antibody 25ul