WDR36,GLC1G,TA-WDRP
  • WDR36,GLC1G,TA-WDRP

Anti-WDR36 Antibody 25ul

Ref: AN-HPA037796-25ul
Anti-WDR36

Información del producto

Polyclonal Antibody against Human WDR36, Gene description: WD repeat domain 36, Alternative Gene Names: GLC1G, TA-WDRP, UTP21, Validated applications: ICC, IHC, Uniprot ID: Q8NI36, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WDR36
Gene Description WD repeat domain 36
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence APLNVSMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPADYVPSIVMLPGTCQTQDVEVSEETVEPSDELIEYDSPEQLNEQLVTLS
Immunogen APLNVSMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPADYVPSIVMLPGTCQTQDVEVSEETVEPSDELIEYDSPEQLNEQLVTLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GLC1G, TA-WDRP, UTP21
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NI36
HTS Code 3002150000
Gene ID 134430
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-WDR36 Antibody 25ul

Anti-WDR36 Antibody 25ul