MAT2B,MATIIbeta
  • MAT2B,MATIIbeta

Anti-MAT2B Antibody 100ul

Ref: AN-HPA037722-100ul
Anti-MAT2B

Información del producto

Polyclonal Antibody against Human MAT2B, Gene description: methionine adenosyltransferase II, beta, Alternative Gene Names: MATIIbeta, SDR23E1, Validated applications: IHC, WB, Uniprot ID: Q9NZL9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAT2B
Gene Description methionine adenosyltransferase II, beta
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence MFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFN
Immunogen MFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MATIIbeta, SDR23E1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NZL9
HTS Code 3002150000
Gene ID 27430
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MAT2B Antibody 100ul

Anti-MAT2B Antibody 100ul