AURKB,Aik2,AIM-1
  • AURKB,Aik2,AIM-1

Anti-AURKB Antibody 25ul

Ref: AN-HPA037708-25ul
Anti-AURKB

Información del producto

Polyclonal Antibody against Human AURKB, Gene description: aurora kinase B, Alternative Gene Names: Aik2, AIM-1, ARK2, AurB, IPL1, PPP1R48, STK12, STK5, Validated applications: ICC, Uniprot ID: Q96GD4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name AURKB
Gene Description aurora kinase B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID
Immunogen WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Aik2, AIM-1, ARK2, AurB, IPL1, PPP1R48, STK12, STK5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96GD4
HTS Code 3002150000
Gene ID 9212
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-AURKB Antibody 25ul

Anti-AURKB Antibody 25ul