BCS1L,BCS,BJS,h-BCS
  • BCS1L,BCS,BJS,h-BCS

Anti-BCS1L Antibody 25ul

Ref: AN-HPA037701-25ul
Anti-BCS1L

Información del producto

Polyclonal Antibody against Human BCS1L, Gene description: BC1 (ubiquinol-cytochrome c reductase) synthesis-like, Alternative Gene Names: BCS, BJS, h-BCS, Hs.6719, Validated applications: IHC, WB, Uniprot ID: Q9Y276, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BCS1L
Gene Description BC1 (ubiquinol-cytochrome c reductase) synthesis-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LEHSICLLSLTDSSLSDDRLNHLLSVAPQQSLVLLEDVDAAFLSRDLAVENPVKYQGLGRLTFSGLLNALDGVASTEARIVFMTTNH
Immunogen LEHSICLLSLTDSSLSDDRLNHLLSVAPQQSLVLLEDVDAAFLSRDLAVENPVKYQGLGRLTFSGLLNALDGVASTEARIVFMTTNH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BCS, BJS, h-BCS, Hs.6719
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y276
HTS Code 3002150000
Gene ID 617
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BCS1L Antibody 25ul

Anti-BCS1L Antibody 25ul