MAML1,KIAA0200,Mam-1
  • MAML1,KIAA0200,Mam-1

Anti-MAML1 Antibody 25ul

Ref: AN-HPA037687-25ul
Anti-MAML1

Información del producto

Polyclonal Antibody against Human MAML1, Gene description: mastermind-like 1 (Drosophila), Alternative Gene Names: KIAA0200, Mam-1, Validated applications: ICC, IHC, Uniprot ID: Q92585, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MAML1
Gene Description mastermind-like 1 (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence QLGSPQVRAGSAGQTFLGPSSAPVSTDSPSLGGSQTLFHTSGQPRADNPSPNLMPASAQAQNAQRALAGVVLPSQGPGGASELSSAHQLQQIAAKQKREQMLQNPQ
Immunogen QLGSPQVRAGSAGQTFLGPSSAPVSTDSPSLGGSQTLFHTSGQPRADNPSPNLMPASAQAQNAQRALAGVVLPSQGPGGASELSSAHQLQQIAAKQKREQMLQNPQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0200, Mam-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92585
HTS Code 3002150000
Gene ID 9794
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MAML1 Antibody 25ul

Anti-MAML1 Antibody 25ul