TANK,I-TRAF,TRAF2
  • TANK,I-TRAF,TRAF2

Anti-TANK Antibody 100ul

Ref: AN-HPA037676-100ul
Anti-TANK

Información del producto

Polyclonal Antibody against Human TANK, Gene description: TRAF family member-associated NFKB activator, Alternative Gene Names: I-TRAF, TRAF2, Validated applications: ICC, IHC, WB, Uniprot ID: Q92844, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TANK
Gene Description TRAF family member-associated NFKB activator
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence EQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLT
Immunogen EQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQDNNYGCVPLLEDSETRKNNLT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names I-TRAF, TRAF2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92844
HTS Code 3002150000
Gene ID 10010
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TANK Antibody 100ul

Anti-TANK Antibody 100ul